PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_014445-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 310aa    MW: 34505.6 Da    PI: 6.6308
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_014445-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.92.5e-34157214259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C vkk+vers++dp++v++tYeg+H+h+
  NNU_014445-RA 157 EDGYRWRKYGQKAVKNSPFPRSYYRCTSATCGVKKRVERSSDDPSIVVTTYEGQHTHP 214
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381303.1E-1061310IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.802.2E-35141216IPR003657WRKY domain
SuperFamilySSF1182901.05E-29148216IPR003657WRKY domain
PROSITE profilePS5081131.95151216IPR003657WRKY domain
SMARTSM007745.3E-41156215IPR003657WRKY domain
PfamPF031061.1E-27157214IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEKKETTMET DNSIGATTFS DQIPTTFSLS SIFDMSCEGE KGSLGIMDLL GIQDFTPSIF  60
DLLQQPSTLL PPSPPPPLPP TSSLPESSEV LNLPATPNSS SISSSSTEAA NDEQTKAVEE  120
EEQEKTKKQL KPKKKNQKRQ REPRFAFMTK SEVDHLEDGY RWRKYGQKAV KNSPFPRSYY  180
RCTSATCGVK KRVERSSDDP SIVVTTYEGQ HTHPSPVMPR GSSTGISSDS GSYGAAFAMP  240
MQLTQSHFQQ QQQQQQPHFH NLPPLNFNSN ISSSPTFVQE RRFCTSAASF LRDHGLLQDV  300
VPSDMMIKKE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-271492161077Probable WRKY transcription factor 4
2lex_A3e-271492161077Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010267939.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229005e-64WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLG8Z9V51e-126G8Z9V5_HEVBR; WRKY1
STRINGVIT_05s0077g00730.t011e-117(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.13e-46WRKY DNA-binding protein 48